• Picture of a small vial with a yellow label that reads "Ento-F Fibroblast Growth Factor Growth Media Supplement." Future Fields Ento-F Recombinant Bovine FGF2 Enriched Growth Media Supplement can directly replace FGF2 needs in cell culture.
  • Buying more than 500 micrograms? Please contact sales@futurefields.io.
1 2

Future Fields

Ento-F FGF2

$62.50 USD
$62.50 USD
Sale Sold out
Volume

IN PRODUCTION. GET NOTIFIED WHEN BACK IN STOCK.

For inquiries, please contact sales@futurefields.io.

Future Fields Ento-F is a Recombinant Bovine FGF2 Growth Media supplement that comes as a lyophilized mixture measured by total recombinant FGF2 mass and is produced with the EntoEngine™ recombinant protein expression system.

Ento-F can directly replace FGF2 needs in cell culture and is optimized for large-scale cell culture applications where maximizing cell mass and viability are a primary consideration. Ento-F can be reconstituted and added to cell culture media to stimulate the FGF-receptor pathway resulting in the downstream activation of the MAPK/ERK pathway, providing cells with strong survival and proliferation signals. Alongside excellent functionality, Ento-F is a cost effective and sustainable alternative to other recombinant FGF2 products on the market.

This product is currently available for Research Use Only.

Please see below for supporting documentation.

Please email sales@futurefields.io for bulk pricing.

Synonym

Basic Fibroblast Growth Factor, bFGF, FGF2, HBGF-2; heparin-binding growth factor 2; Prostatropin

Description

FGF2 is a member of the FGF family (one of 23) of proteins. It is a bioactive protein intended for use in cell culture applications. Members of this protein family bind heparin and possess broad mitogenic and angiogenic functions. They play a central role in the regeneration of a variety of tissues, promoting cellular proliferation in in vitro culture. Recombinant Bovine FGF2 produced by the EntoEngine™ is a single, non-glycosylated, polypeptide chain containing 155 amino acids and has a molecular mass of 17.3 kDa.

Sequence (monomer):

MAAGSITTLPSLPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS

Purity

Ento-F is a technical grade product which is shipped containing the listed amount of recombinant bovine FGF2 within a complex heterogeneous mixture. Please see FAQs for details.

Source

Drosophila melanogaster

Documents
⇲ Safety Data Sheet
⇲ Sample Product Specification Sheet

Articles
Future Fields' FGF2 Performance
March 17, 2022

Frequently Asked Questions

What is the shelf-life of this product?
The shelf-life is in our specification sheet.

The product arrived but was shipped at room temperature, is it OK?
Yes. We ship this product lyophilized. Please see the specification sheet for suggsted on-site storage conditions.

How do I get a Certificate of Analysis?
A certificate of analysis is not yet available for this product.

Can this product be used to culture cells other than bovine species?
Yes! We have seen our products used successfully in a variety of cell cultures across land-dwelling and aquatic species.

What does technical grade mean?
Ento products are referred to as technical grade. They are heterogeneous mixtures which contain host proteins, lipids, and other components from the expression system (D. melanogaster) in addition to the listed amount of recombinant protein(s) of interest (recombinant bovine FGF2, in this case).

All Ento products are rigorously tested to ensure that both the background molecular profile of the supplement and the protein of interest pass all quality and safety testing requirements.

Has any food safety testing been performed for this product?

A certificate of analysis is not yet available for this product.

Are volume discounts or recurring order discounts available for this product?
Yes. Please reach out to sales@futurefields.io to discuss your needs.