Skip to product information
1 of 1

Future Fields

Recombinant Bovine FGF2

Regular price $148.91 USD
Regular price Sale price $148.91 USD
Sale Sold out
Volume

Future Fields Recombinant Bovine FGF2 (> 95 % purity) produced with the EntoEngine™ expression platform fulfills the needs of FGF2 requirements in cell culture across a variety of land-dwelling and aquatic species.

Our purified bovine FGF2 is a high-performing drop-in replacement for commercially available recombinant FGF2 in driving proliferation of cells that express FGF-receptors. Purified Bovine FGF2 produced in the EntoEngine™ has been confirmed to activate the FGF receptors via the activation of ERK1/2 pathways. We use proprietary extraction and purification technologies to produce functional high quality FGF2 that is ready for cell cultures.

Our purified FGF2 comes as a lyophilized powder, which when reconstituted is ready to be supplemented into cell culture media.

Future Fields products are currently available for Research Use Only.

Please see below for supporting documentation.

For bulk order discounts, please email sales@futurefields.io.

 


Synonym

Basic Fibroblast Growth Factor, bFGF, FGF2, HBGF-2; heparin-binding growth factor 2; Prostatropin

Description

FGF2 is a member of the FGF family (one of 23) of proteins. It is a bioactive protein intended for use in cell culture applications. Members of this protein family bind heparin and possess broad mitogenic and angiogenic functions. They play a central role in the regeneration of a variety of tissues, promoting cellular proliferation in in vitro culture. Recombinant Bovine FGF2 is produced as a single, non-glycosylated, polypeptide chain containing 155 amino acids and has a molecular mass of 17.3 kDa.

Sequence (monomer):

MAAGSITTLPSLPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS

Purity

Species

This FGF2 product has >95% purity as measured by SDS PAGE.

Bos taurus

Source

Drosophila melanogaster


Frequently Asked Questions

What is the shelf-life of this product?
Shelf-life is in our specification sheet.

The product arrived but was shipped at room temperature, is it OK?
Yes. We ship this product lyophilized. Please see the specification sheet for suggested on-site storage conditions.

How do I get a Certificate of Analysis?
A certificate of analysis is not yet available for this product.

Can this product be used to culture cells other than bovine species?
Yes! We have seen this product successfully in a variety of cell cultures across land-dwelling and aquatic species.

Are volume discounts or recurring order discounts available for this product?
Yes. Please reach out to sales@futurefields.io to discuss your needs.


See more proteins